[chimerax-users] Problem with ChimeraX
Tom Goddard
goddard at sonic.net
Wed Mar 23 22:34:28 PDT 2022
To run AlphaFold for more than one sequence you need the ChimeraX daily build (aka 1.4). The error you got suggests you are using ChimeraX 1.3 which only handles a single sequence.
The Internal Server Error can be ignored -- it may be the UCSF servers are down, it is just trying to check what plugins are available.
Tom
> On Mar 23, 2022, at 6:29 PM, Gawargi, Flobater I via ChimeraX-users <chimerax-users at cgl.ucsf.edu> wrote:
>
> Hi,
> I am a new Chimerax user and I have encountered a problem that I hope you can help me fix. I installed 1.4 version and it shows "Startup Messages notes available bundle cache has not been initialized yet Updating list of available bundles failed: Internal Server Error” all I am trying to do is use alpha fold to predict structure of 2 proteins separated by comma. And it shows this error "Missing or invalid "sequences" argument: Sequences argument "cvfpfvflgkqyssctsdgrrdgrlwcattsnfdtdkkwgfcpdqgyslflvaahefghalgldhssvpealmyplysylegfplnkddidgiqylygrgskpdprppattttepqptapptmcptipptayptvgptvgptgapspgptsspspgptgapspgptapptagsseasteslspadnpcnvdvfdaiaeiqgalhffkdgwywkflnhrgsplqgpfltartw" is not a chain specifier, alignment id, UniProt id, or sequence characters”
> I am using an M1 MacBook, but I have also tried it on windows running windows 10 and got the same issue. I would appreciate your input to fix this issue.
>
> Thank you,
> Flobater Gawargi
>
>
>
>
>
>
>
> The information in this e-mail may be privileged and confidential, intended only for the use of the addressee(s) above. Any unauthorized use or disclosure of this information is prohibited. If you have received this e-mail by mistake, please delete it and immediately contact the sender.
> _______________________________________________
> ChimeraX-users mailing list
> ChimeraX-users at cgl.ucsf.edu
> Manage subscription:
> https://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users
-------------- next part --------------
An HTML attachment was scrubbed...
URL: <http://www.rbvi.ucsf.edu/pipermail/chimerax-users/attachments/20220323/d64399a2/attachment.html>
More information about the ChimeraX-users
mailing list