| 1 | # Fetch ID
|
|---|
| 2 | open 6NQ3
|
|---|
| 3 |
|
|---|
| 4 | # Set up the structures to view
|
|---|
| 5 | select all ; show sel cartoons; style sel stick; hide sel atoms
|
|---|
| 6 | select /A,B,C,G,D,H ; hide sel cartoons
|
|---|
| 7 | select /E ; color (#!1 & sel) purple
|
|---|
| 8 | select /F ; color (#!1 & sel) cyan
|
|---|
| 9 | select clear
|
|---|
| 10 |
|
|---|
| 11 | # Set starting view
|
|---|
| 12 | set bgColor white
|
|---|
| 13 | lighting soft
|
|---|
| 14 | graphics silhouettes true
|
|---|
| 15 | view
|
|---|
| 16 | view name start
|
|---|
| 17 |
|
|---|
| 18 | # Start the movie production
|
|---|
| 19 | movie record supersample 1 size 720,720 limit 5000 directory ~/Desktop/tmp_chimera pattern Frame_n*
|
|---|
| 20 |
|
|---|
| 21 | # Set starting through the hole of Rbbp4
|
|---|
| 22 | turn z -70
|
|---|
| 23 | turn x 24
|
|---|
| 24 | turn y -40
|
|---|
| 25 | view name hole
|
|---|
| 26 | wait 5
|
|---|
| 27 |
|
|---|
| 28 | # colour Histone-binding protein RBBP4 or subunit C of CAF1 complex; Region: CAF1C_H4-bd; pfam12265
|
|---|
| 29 | select sequence EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLP ; color sel orange
|
|---|
| 30 | select clear ; wait 10
|
|---|
| 31 |
|
|---|
| 32 | # Colour the WD40 repeat 1
|
|---|
| 33 | select sequence NHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYT ; color sel spring green
|
|---|
| 34 | select clear ; wait 10
|
|---|
| 35 | # Colour the WD40 repeat 2
|
|---|
| 36 | select sequence GHQKEGYGLSWNPNLSGHLLSASDDHTICLWD ; color sel spring green
|
|---|
| 37 | select clear ; wait 10
|
|---|
| 38 | # WD40 repeat 3
|
|---|
| 39 | select sequence GHTAVVEDVSWHLLHESLFGSVADDQKLMIWD ; color sel spring green
|
|---|
| 40 | select clear ; wait 10
|
|---|
| 41 | # WD40 repeat 4
|
|---|
| 42 | select sequence AHTAEVNCLSFNPYSEFILATGSADKTVALWD ; color sel spring green
|
|---|
| 43 | select clear ; wait 10
|
|---|
| 44 | # WD40 repeat 5
|
|---|
| 45 | select sequence SHKDEIFQVQWSPHNETILASSGTDRRLNVWD ; color sel spring green
|
|---|
| 46 | select clear ; wait 10
|
|---|
| 47 | # WD40 repeat 6
|
|---|
| 48 | select sequence GHTAKISDFSWNPNEPWVICSVSEDNIMQVWQ ; color sel spring green
|
|---|
| 49 | select clear ; wait 10
|
|---|
| 50 |
|
|---|
| 51 | # Show altenative exon
|
|---|
| 52 | select sequence RKTFKVDDMLSKVEKMKGEQESH
|
|---|
| 53 | color sel red
|
|---|
| 54 | select clear
|
|---|
| 55 | wait 10
|
|---|
| 56 |
|
|---|
| 57 |
|
|---|
| 58 | # All structure overview
|
|---|
| 59 | turn x 20 120 rock 120 ; wait
|
|---|
| 60 | turn y 35 150 rock 150 ; wait
|
|---|
| 61 | turn y 4 90 ; wait
|
|---|
| 62 |
|
|---|
| 63 |
|
|---|
| 64 | # Show first point of interaction with yellow region
|
|---|
| 65 | turn y 1 50 ; wait
|
|---|
| 66 | turn x 1 35 ; wait
|
|---|
| 67 | zoom 1.5 80 ; wait
|
|---|
| 68 | move x 0.75 15 ; move y -0.75 15 ; wait
|
|---|
| 69 | view name side
|
|---|
| 70 |
|
|---|
| 71 | # Show side chains interacting
|
|---|
| 72 | select /E:9-28 /E:32-39
|
|---|
| 73 | show sel atoms
|
|---|
| 74 | hbonds sel
|
|---|
| 75 | select clear
|
|---|
| 76 | wait 20
|
|---|
| 77 | turn x 15 60 rock 60 ; wait
|
|---|
| 78 | turn y 15 60 rock 60; wait
|
|---|
| 79 |
|
|---|
| 80 | # remove hydrogen bonds and
|
|---|
| 81 | ~hbonds
|
|---|
| 82 | select /E:9-28 /E:32-39
|
|---|
| 83 | hide sel atoms
|
|---|
| 84 | select clear
|
|---|
| 85 | wait 5
|
|---|
| 86 |
|
|---|
| 87 | # go back
|
|---|
| 88 | move y 0.75 15 ; move x -0.75 15 ; wait
|
|---|
| 89 | zoom 0.5 80 ; wait
|
|---|
| 90 | turn -x 1 35 ; wait
|
|---|
| 91 | turn -y 1 50 ; wait
|
|---|
| 92 | view hole
|
|---|
| 93 | # the going back to 'hole' position is a bit abrupt
|
|---|
| 94 |
|
|---|
| 95 | # Close up to region 1
|
|---|
| 96 | move x 0.75 25 ; move y -0.5 25 ; wait 25
|
|---|
| 97 | turn x 0.5 25 ; zoom 3 80 ; wait 80
|
|---|
| 98 | turn x 0.75 25 ; move y 0.5 25 ; wait 25
|
|---|
| 99 | view name zoom1
|
|---|
| 100 |
|
|---|
| 101 | # Show residues interacting with R129
|
|---|
| 102 | select /F:129 /E:409 /E:346 ; show sel atoms; color (#!1 & sel) byelement ; hbonds sel
|
|---|
| 103 | select clear
|
|---|
| 104 | wait 15
|
|---|
| 105 | turn -y 15 120 rock 120 ; wait
|
|---|
| 106 | turn x 15 60 rock 130 ; wait
|
|---|
| 107 | wait 15
|
|---|
| 108 | view name zoom2
|
|---|
| 109 |
|
|---|
| 110 | # Move to next site Asp 129
|
|---|
| 111 | turn y -1.5 25 ; move x -0.5 25 ; wait 25
|
|---|
| 112 | turn x -1 25 ; turn z 1 25 ; move x 0.4 25 ; wait 25
|
|---|
| 113 |
|
|---|
| 114 | # Show residues interacting with ASP135
|
|---|
| 115 | select /F:135 /E:285,304,330 ; show sel atoms; color (#!1 & sel) byelement ; hbonds sel
|
|---|
| 116 | select clear
|
|---|
| 117 | turn y -10 120 rock 180 ; wait
|
|---|
| 118 | turn x 15 120 rock 120 ; wait
|
|---|
| 119 | wait 20
|
|---|
| 120 | view name zoom3
|
|---|
| 121 |
|
|---|
| 122 | # zoom out and move to other region
|
|---|
| 123 | zoom 0.5 50 ; turn -y 1 150 ; wait
|
|---|
| 124 | move x 0.75 15 ; wait
|
|---|
| 125 | turn x 1 20 ; wait
|
|---|
| 126 | zoom 1.5 50
|
|---|
| 127 |
|
|---|
| 128 | # Select last interaction area
|
|---|
| 129 | select /F:370,375 /E:270,309,314
|
|---|
| 130 | show sel atoms
|
|---|
| 131 | hbonds sel
|
|---|
| 132 | select clear
|
|---|
| 133 |
|
|---|
| 134 | # Final show
|
|---|
| 135 | turn x 15 60 rock 130
|
|---|
| 136 | turn -y 15 60 rock 130
|
|---|
| 137 |
|
|---|
| 138 | # Print status in log
|
|---|
| 139 | movie status
|
|---|
| 140 |
|
|---|
| 141 | # Export movie
|
|---|
| 142 | movie encode ~/Desktop/Suz12_test1.mp4 format h264 quality low wait true verbose false
|
|---|
| 143 | # close
|
|---|
![[ChimeraX Issue Tracking System]](/trac/ChimeraX/chrome/site/ChimeraX-icon.svg){kind=icon}
